PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHM99174.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TCP
Protein Properties Length: 114aa    MW: 13001.8 Da    PI: 7.5613
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHM99174.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP868.9e-2753111260
         TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaik 60 
                 ++k+++++++hTkv+gR  R+R+sa+ a  +F+L+ eLG++ d++tieWLlqq +pa++
  KHM99174.1  53 PPKQTSTKDRHTKVDGREQRIRMSALYATCIFQLTHELGHKLDGETIEWLLQQVEPACD 111
                 7899*****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036349.2E-2257110IPR005333Transcription factor, TCP
PROSITE profilePS5136919.08159113IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 114 aa     Download sequence    Send to blast
MDTCSPKLLS SLFPEAYDIQ QSPQNRARPI QPDPTSSPWL VAMVEAPNSK KPPPKQTSTK  60
DRHTKVDGRE QRIRMSALYA TCIFQLTHEL GHKLDGETIE WLLQQVEPAC DRHH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007155318.11e-29hypothetical protein PHAVU_003G190900g
SwissprotQ9C9L26e-28TCP15_ARATH; Transcription factor TCP15
TrEMBLA0A0B2NQ541e-81A0A0B2NQ54_GLYSO; Transcription factor TCP15
STRINGGLYMA05G01131.16e-28(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21203280
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58100.19e-24TCP family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]